], // enable redirect to login page when "logmein" is typed into the void =) } "actions" : [ ] } }, ] "action" : "pulsate" } LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ], "selector" : "#messageview_2", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "", { }, } })(LITHIUM.jQuery); ] "truncateBodyRetainsHtml" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2499035 .lia-rating-control-passive', '#form_5'); "context" : "envParam:quiltName,expandedQuiltName", { "initiatorBinding" : true, } } }, "event" : "MessagesWidgetAnswerForm", "actions" : [ "actions" : [ "actions" : [ "showCountOnly" : "false", { "action" : "rerender" { "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" }, ', 'ajax'); { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1677183,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); }, resetMenu(); "actions" : [ // If watching, pay attention to key presses, looking for right sequence. { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); Vodafone-Kunden können aufatmen und die CallYa-Flex-App für den beliebten Prepaid-Tarif wieder benutzen. { $('.js-close-header-announcement').on('click', clickHandler); ] "context" : "envParam:entity", } "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "editProductMessage", "event" : "RevokeSolutionAction", "componentId" : "forums.widget.message-view", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); }, ] "disableLabelLinks" : "false", "eventActions" : [ { { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" if ( count == neededkeys.length ) { "displayStyle" : "horizontal", "}); { "context" : "envParam:quiltName,product,contextId,contextUrl", // We're good so far. }); "eventActions" : [ "event" : "MessagesWidgetAnswerForm", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_219cc17f18856b', 'enableAutoComplete', '#ajaxfeedback_219cc17f18856b_0', 'LITHIUM:ajaxError', {}, 's_Vf2nqMd1mAlQAsFSEaescwdVu5ZnI8Q_79u-9uFpU. "message" : "2495503", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); { { { { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", // Set start to true only if the first key in the sequence is pressed "action" : "rerender" "action" : "rerender" // console.log('watching: ' + key); "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { if ( neededkeys[count] == key ) { "forceSearchRequestParameterForBlurbBuilder" : "false", } ', 'ajax'); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ { { "context" : "", "truncateBodyRetainsHtml" : "false", "action" : "rerender" } "actions" : [ { "disableLabelLinks" : "false", ] }, } "context" : "envParam:quiltName,expandedQuiltName", $(document).ready(function(){ }); ] ] { "action" : "rerender" { "context" : "envParam:quiltName", { LITHIUM.Dialog.options['1317825209'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ;(function($) { { "event" : "MessagesWidgetEditAction", ] "action" : "rerender" } "actions" : [ "action" : "pulsate" LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-kudos-id" "includeRepliesModerationState" : "false", "context" : "envParam:entity", "event" : "kudoEntity", { "actions" : [ "activecastFullscreen" : false, ], { }, "action" : "rerender" }, ] "actions" : [ "displayStyle" : "horizontal", "action" : "rerender" } "action" : "rerender" "action" : "pulsate" "actions" : [ }, { "action" : "rerender" "actions" : [ "useCountToKudo" : "false", "event" : "approveMessage", "event" : "RevokeSolutionAction", { }, } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "disallowZeroCount" : "false", "quiltName" : "ForumMessage", ] }, "displayStyle" : "horizontal", }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { { { "action" : "rerender" "event" : "ProductAnswer", { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "}); { { "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ Das passiert jetzt 11.12.2020 und bereits früher immer wieder so. "action" : "rerender" ] "event" : "ProductMessageEdit", { "defaultAriaLabel" : "", }, }, ] } "initiatorBinding" : true, "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } }); Ich kann es mir gern ansehen für Dich, bitte sende mir eine PN zu mit Deiner Handynummer. LITHIUM.Dialog({ "action" : "rerender" // console.log(key); } "context" : "", ;(function($) {
"event" : "markAsSpamWithoutRedirect", "disableKudosForAnonUser" : "false", ] "event" : "MessagesWidgetAnswerForm", "linkDisabled" : "false" ] "event" : "unapproveMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", } ] //$('#community-menu-toggle').removeClass('active') ] ] "actions" : [ { "event" : "deleteMessage", "context" : "", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", // Oops. "event" : "MessagesWidgetCommentForm", "event" : "deleteMessage", "useTruncatedSubject" : "true", { expireDate.setDate(expireDate.getDate() + 365*10); "context" : "", "revokeMode" : "true", logmein: [76, 79, 71, 77, 69, 73, 78], }, { })(LITHIUM.jQuery);
"action" : "pulsate" "action" : "rerender" } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'G34tCW_DCuuf_sZLAUqEJB8pCnydsbpvIUuiocYhOcQ. "displayStyle" : "horizontal", "action" : "rerender" //$(window).scroll(function() { "actions" : [ "event" : "approveMessage", } { }, "event" : "deleteMessage", }); } }, } var clickedDomElement = $(this); ', 'ajax'); "event" : "MessagesWidgetEditAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { }, "event" : "kudoEntity", "action" : "rerender" $('li.close-on-click').on('click',resetMenu); { "action" : "rerender" { "actions" : [ "actions" : [ { } "action" : "pulsate" "componentId" : "forums.widget.message-view", "event" : "addThreadUserEmailSubscription", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] "action" : "rerender" "event" : "addMessageUserEmailSubscription", { { "actions" : [ "context" : "envParam:feedbackData", "action" : "rerender" { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "unapproveMessage", count++; //if(height > 430) { })(LITHIUM.jQuery); } ] "actions" : [ { LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "event" : "MessagesWidgetMessageEdit", event.returnValue = false; "truncateBodyRetainsHtml" : "false", "}); "context" : "", { { "context" : "", Vodafone: Callya-Flex-App funktioniert wieder nicht. "event" : "RevokeSolutionAction", if ( count == neededkeys.length ) { "event" : "addThreadUserEmailSubscription", "displaySubject" : "true", "actions" : [ "includeRepliesModerationState" : "false", }, } "quiltName" : "ForumMessage", "context" : "envParam:quiltName,expandedQuiltName", { "context" : "envParam:feedbackData", "action" : "rerender" "disableLinks" : "false", Bist du sicher, dass du fortfahren möchtest? "initiatorBinding" : true, { ] }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "addThreadUserEmailSubscription", { ] { "action" : "rerender" "context" : "envParam:selectedMessage", { }, ] { "actions" : [ "actions" : [ });
], LITHIUM.AjaxSupport.ComponentEvents.set({ "kudosable" : "true", } "context" : "", "actions" : [ "context" : "", { } "actions" : [ "actions" : [ } ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'CSL-thTGSOD6bSimhPpWdsDKEhVDkpbhCvCtXVZheKE. "kudosable" : "true", { "event" : "editProductMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); }, "useSubjectIcons" : "true", }, LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; MeinVodafone-App nutzen. }, ] "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }, "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ // just for convenience, you need a login anyways... "actions" : [ "action" : "rerender" "action" : "rerender" "context" : "", { "displayStyle" : "horizontal", } ] { "context" : "", { "context" : "envParam:quiltName,message", Mit 15 € ging es dann letztendlich. "action" : "rerender" ], "event" : "MessagesWidgetEditAnswerForm", { "context" : "", "event" : "expandMessage", "entity" : "2499035", { { } { "event" : "MessagesWidgetEditCommentForm", // console.log(key); // enable redirect to login page when "logmein" is typed into the void =) "context" : "", "actions" : [ "event" : "ProductAnswerComment", // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName,product,contextId,contextUrl", "message" : "1681439", "actions" : [ }, "action" : "rerender" "kudosable" : "true", { ] ] }, } Hallo - leider funktioniert meine CallYa Flex App seit dem Monatswechsel zum Oktober nciht mehr. ] { { "disableLabelLinks" : "false", { ] ] { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } "parameters" : { } "context" : "", "action" : "rerender" } "action" : "rerender" var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "forceSearchRequestParameterForBlurbBuilder" : "false", "buttonDialogCloseAlt" : "Schließen", "event" : "MessagesWidgetCommentForm", { "actions" : [ "context" : "", "action" : "rerender" "useTruncatedSubject" : "true", if ( key == neededkeys[0] ) { "showCountOnly" : "false", } { "context" : "", "actions" : [ ] "context" : "", }, } "event" : "MessagesWidgetMessageEdit", var count = 0; } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", $(this).next().toggle();
"componentId" : "forums.widget.message-view", "event" : "kudoEntity", "event" : "removeThreadUserEmailSubscription", "truncateBody" : "true", "actions" : [ "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName,message", ;(function($) { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "displayStyle" : "horizontal", "context" : "", { "context" : "", "actions" : [ "componentId" : "kudos.widget.button", "event" : "removeThreadUserEmailSubscription", "useSimpleView" : "false", "useSimpleView" : "false", "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "message" : "2497793", "parameters" : { } ] "disableLinks" : "false", }, ', 'ajax'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "initiatorBinding" : true, "event" : "AcceptSolutionAction", ] "action" : "rerender" } else { "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "AcceptSolutionAction", "actions" : [ "event" : "ProductAnswer", { }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1679305 .lia-rating-control-passive', '#form_3'); } { "event" : "ProductMessageEdit", ', 'ajax'); "useCountToKudo" : "false", "actions" : [ "actions" : [ } ] "actions" : [ "actions" : [ }, { })(LITHIUM.jQuery);
}, "actions" : [ { "context" : "", "action" : "rerender" Evtl. "action" : "rerender" ;(function($) { }, "context" : "", // --> { "action" : "rerender" ] { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); createStorage("false"); } ] "revokeMode" : "true", { { "initiatorDataMatcher" : "data-lia-message-uid" } "displaySubject" : "true", //if(height > 430) { "actions" : [ $(document).ready(function(){ } "action" : "rerender" $(".label-tag-accordion div.js-toggle-more").on('click',function(e){
{ ] "useSubjectIcons" : "true", { var keycodes = { } var notifCount = 0; } } { }, } "context" : "envParam:quiltName,expandedQuiltName", { Betreff: Bitte um Klärung wegen Callya und unermüd... Re: Restguthaben gekündigter SIM übertragen. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, ;(function($) { "closeEvent" : "LITHIUM:lightboxCloseEvent", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); watching = false; { LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "context" : "envParam:selectedMessage", "componentId" : "forums.widget.message-view", "actions" : [ "event" : "MessagesWidgetCommentForm", "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1679260,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBody" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ️Das letzte mal ist gerade ein paar Tage her. ] "kudosable" : "true", "context" : "", ] }, "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "kudos.widget.button", "event" : "AcceptSolutionAction", { } }, { { "action" : "rerender" }, }); //$(window).scroll(function() { }, }, "truncateBodyRetainsHtml" : "false", $(document).ready(function(){ LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'CSL-thTGSOD6bSimhPpWdsDKEhVDkpbhCvCtXVZheKE. Zusätzlich zur Aufladung bietet diese App für zahlreiche Mobilfunkanbieter die Anzeige Ihres Handy Guthabens an. { { ] ] ], } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); } } } "context" : "", }else{ "useSimpleView" : "false", "context" : "", }, } }); "event" : "removeMessageUserEmailSubscription", "entity" : "1681439", } Wenn das Bezahlen mit PayPal nicht funktioniert, obwohl eine ausreichende Deckung des verknüpften Bankkontos gegeben ist, solltest Du zunächst überprüfen, ob es ein Problem mit der App beziehungsweise dem verwendeten Internet-Browser gibt. } "}); "event" : "removeThreadUserEmailSubscription", "event" : "editProductMessage", "event" : "MessagesWidgetEditAction", { "kudosLinksDisabled" : "false", watching = false; } "event" : "addThreadUserEmailSubscription", }); }, $(document).ready(function(){ "quiltName" : "ForumMessage", count = 0; Als Postbank Kunde können Sie Ihr Prepaid-Handy ganz einfach überall aufladen – oder auch die Telefone von Freunden und Familie. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "pulsate" "event" : "ProductAnswer", "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" { }, { ] }); "buttonDialogCloseAlt" : "Schließen", "event" : "editProductMessage", }, "action" : "rerender" "event" : "unapproveMessage", "context" : "", "action" : "rerender" "action" : "rerender" }, "context" : "envParam:feedbackData", "actions" : [ ] "initiatorBinding" : true, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "actions" : [ { { }); { }, ] "action" : "rerender" }, "context" : "", // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ } "action" : "rerender" "event" : "deleteMessage", }, }, { } }, ] "componentId" : "forums.widget.message-view", "parameters" : { "event" : "RevokeSolutionAction", watching = false; } ] "actions" : [ }, { ] Ich frage mich nur, warum 5 € Aufladung angeboten werden, wenn es doch nicht möglich ist. { { }, }, "kudosLinksDisabled" : "false", } "actions" : [ "actions" : [ { } ] "actions" : [ "event" : "RevokeSolutionAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1676536 .lia-rating-control-passive', '#form'); "action" : "rerender" "initiatorBinding" : true, }); ', 'ajax'); } { "action" : "rerender" "actions" : [ //$(window).scroll(function() { ] } "event" : "MessagesWidgetEditCommentForm", Execute whatever should happen when entering the right sequence "actions" : [ }, { "initiatorDataMatcher" : "data-lia-message-uid" { var key = e.keyCode; "action" : "rerender" "action" : "rerender" { // Oops, not the right sequence, lets restart from the top. ;(function($) { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"};
Letzter Wille Fische, Schulamt Nürnberg Stellenangebote, Beinpresse Für Zuhause, Gerald Ford Flugzeugträger, Die Linke Bundestag Jobs, Das Traumschiff Brasilien 2012,
Letzter Wille Fische, Schulamt Nürnberg Stellenangebote, Beinpresse Für Zuhause, Gerald Ford Flugzeugträger, Die Linke Bundestag Jobs, Das Traumschiff Brasilien 2012,