], // enable redirect to login page when "logmein" is typed into the void =) } "actions" : [ ] } }, ] "action" : "pulsate" } LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ], "selector" : "#messageview_2", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "", { }, } })(LITHIUM.jQuery); ] "truncateBodyRetainsHtml" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2499035 .lia-rating-control-passive', '#form_5'); "context" : "envParam:quiltName,expandedQuiltName", { "initiatorBinding" : true, } } }, "event" : "MessagesWidgetAnswerForm", "actions" : [ "actions" : [ "actions" : [ "showCountOnly" : "false", { "action" : "rerender" { "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" }, ', 'ajax'); { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1677183,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); }, resetMenu(); "actions" : [ // If watching, pay attention to key presses, looking for right sequence. { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); Vodafone-Kunden können aufatmen und die CallYa-Flex-App für den beliebten Prepaid-Tarif wieder benutzen. { $('.js-close-header-announcement').on('click', clickHandler); ] "context" : "envParam:entity", } "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "editProductMessage", "event" : "RevokeSolutionAction", "componentId" : "forums.widget.message-view", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); }, ] "disableLabelLinks" : "false", "eventActions" : [ { { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" if ( count == neededkeys.length ) { "displayStyle" : "horizontal", "}); { "context" : "envParam:quiltName,product,contextId,contextUrl", // We're good so far. }); "eventActions" : [ "event" : "MessagesWidgetAnswerForm", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_219cc17f18856b', 'enableAutoComplete', '#ajaxfeedback_219cc17f18856b_0', 'LITHIUM:ajaxError', {}, 's_Vf2nqMd1mAlQAsFSEaescwdVu5ZnI8Q_79u-9uFpU. "message" : "2495503", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); { { { { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", // Set start to true only if the first key in the sequence is pressed "action" : "rerender" "action" : "rerender" // console.log('watching: ' + key); "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { if ( neededkeys[count] == key ) { "forceSearchRequestParameterForBlurbBuilder" : "false", } ', 'ajax'); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ { { "context" : "", "truncateBodyRetainsHtml" : "false", "action" : "rerender" } "actions" : [ { "disableLabelLinks" : "false", ] }, } "context" : "envParam:quiltName,expandedQuiltName", $(document).ready(function(){ }); ] ] { "action" : "rerender" { "context" : "envParam:quiltName", { LITHIUM.Dialog.options['1317825209'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ;(function($) { { "event" : "MessagesWidgetEditAction", ] "action" : "rerender" } "actions" : [ "action" : "pulsate" LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-kudos-id" "includeRepliesModerationState" : "false", "context" : "envParam:entity", "event" : "kudoEntity", { "actions" : [ "activecastFullscreen" : false, ], { }, "action" : "rerender" }, ] "actions" : [ "displayStyle" : "horizontal", "action" : "rerender" } "action" : "rerender" "action" : "pulsate" "actions" : [ }, { "action" : "rerender" "actions" : [ "useCountToKudo" : "false", "event" : "approveMessage", "event" : "RevokeSolutionAction", { }, } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "disallowZeroCount" : "false", "quiltName" : "ForumMessage", ] }, "displayStyle" : "horizontal", }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { { { "action" : "rerender" "event" : "ProductAnswer", { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "}); { { "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ Das passiert jetzt 11.12.2020 und bereits früher immer wieder so. "action" : "rerender" ] "event" : "ProductMessageEdit", { "defaultAriaLabel" : "", }, }, ] } "initiatorBinding" : true, "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } }); Ich kann es mir gern ansehen für Dich, bitte sende mir eine PN zu mit Deiner Handynummer. LITHIUM.Dialog({ "action" : "rerender" // console.log(key); } "context" : "", ;(function($) { "event" : "markAsSpamWithoutRedirect", "disableKudosForAnonUser" : "false", ] "event" : "MessagesWidgetAnswerForm", "linkDisabled" : "false" ] "event" : "unapproveMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", } ] //$('#community-menu-toggle').removeClass('active') ] ] "actions" : [ { "event" : "deleteMessage", "context" : "", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", // Oops. "event" : "MessagesWidgetCommentForm", "event" : "deleteMessage", "useTruncatedSubject" : "true", { expireDate.setDate(expireDate.getDate() + 365*10); "context" : "", "revokeMode" : "true", logmein: [76, 79, 71, 77, 69, 73, 78], }, { })(LITHIUM.jQuery); "action" : "pulsate" "action" : "rerender" } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'G34tCW_DCuuf_sZLAUqEJB8pCnydsbpvIUuiocYhOcQ. "displayStyle" : "horizontal", "action" : "rerender" //$(window).scroll(function() { "actions" : [ "event" : "approveMessage", } { }, "event" : "deleteMessage", }); } }, } var clickedDomElement = $(this); ', 'ajax'); "event" : "MessagesWidgetEditAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { }, "event" : "kudoEntity", "action" : "rerender" $('li.close-on-click').on('click',resetMenu); { "action" : "rerender" { "actions" : [ "actions" : [ { } "action" : "pulsate" "componentId" : "forums.widget.message-view", "event" : "addThreadUserEmailSubscription", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] "action" : "rerender" "event" : "addMessageUserEmailSubscription", { { "actions" : [ "context" : "envParam:feedbackData", "action" : "rerender" { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "unapproveMessage", count++; //if(height > 430) { })(LITHIUM.jQuery); } ] "actions" : [ { LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "event" : "MessagesWidgetMessageEdit", event.returnValue = false; "truncateBodyRetainsHtml" : "false", "}); "context" : "", { { "context" : "", Vodafone: Callya-Flex-App funktioniert wieder nicht. "event" : "RevokeSolutionAction", if ( count == neededkeys.length ) { "event" : "addThreadUserEmailSubscription", "displaySubject" : "true", "actions" : [ "includeRepliesModerationState" : "false", }, } "quiltName" : "ForumMessage", "context" : "envParam:quiltName,expandedQuiltName", { "context" : "envParam:feedbackData", "action" : "rerender" "disableLinks" : "false", Bist du sicher, dass du fortfahren möchtest? "initiatorBinding" : true, { ] }, { ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "addThreadUserEmailSubscription", { ] { "action" : "rerender" "context" : "envParam:selectedMessage", { }, ] { "actions" : [ "actions" : [ }); ], LITHIUM.AjaxSupport.ComponentEvents.set({ "kudosable" : "true", } "context" : "", "actions" : [ "context" : "", { } "actions" : [ "actions" : [ } ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'CSL-thTGSOD6bSimhPpWdsDKEhVDkpbhCvCtXVZheKE. "kudosable" : "true", { "event" : "editProductMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); }, "useSubjectIcons" : "true", }, LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; MeinVodafone-App nutzen. }, ] "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }, "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ // just for convenience, you need a login anyways... "actions" : [ "action" : "rerender" "action" : "rerender" "context" : "", { "displayStyle" : "horizontal", } ] { "context" : "", { "context" : "envParam:quiltName,message", Mit 15 € ging es dann letztendlich. "action" : "rerender" ], "event" : "MessagesWidgetEditAnswerForm", { "context" : "", "event" : "expandMessage", "entity" : "2499035", { { } { "event" : "MessagesWidgetEditCommentForm", // console.log(key); // enable redirect to login page when "logmein" is typed into the void =) "context" : "", "actions" : [ "event" : "ProductAnswerComment", // If watching, pay attention to key presses, looking for right sequence. "context" : "envParam:quiltName,product,contextId,contextUrl", "message" : "1681439", "actions" : [ }, "action" : "rerender" "kudosable" : "true", { ] ] }, } Hallo - leider funktioniert meine CallYa Flex App seit dem Monatswechsel zum Oktober nciht mehr. ] { { "disableLabelLinks" : "false", { ] ] { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } "parameters" : { } "context" : "", "action" : "rerender" } "action" : "rerender" var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "forceSearchRequestParameterForBlurbBuilder" : "false", "buttonDialogCloseAlt" : "Schließen", "event" : "MessagesWidgetCommentForm", { "actions" : [ "context" : "", "action" : "rerender" "useTruncatedSubject" : "true", if ( key == neededkeys[0] ) { "showCountOnly" : "false", } { "context" : "", "actions" : [ ] "context" : "", }, } "event" : "MessagesWidgetMessageEdit", var count = 0; } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", $(this).next().toggle(); "componentId" : "forums.widget.message-view", "event" : "kudoEntity", "event" : "removeThreadUserEmailSubscription", "truncateBody" : "true", "actions" : [ "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName,message", ;(function($) { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "displayStyle" : "horizontal", "context" : "", { "context" : "", "actions" : [ "componentId" : "kudos.widget.button", "event" : "removeThreadUserEmailSubscription", "useSimpleView" : "false", "useSimpleView" : "false", "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "message" : "2497793", "parameters" : { } ] "disableLinks" : "false", }, ', 'ajax'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "initiatorBinding" : true, "event" : "AcceptSolutionAction", ] "action" : "rerender" } else { "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "AcceptSolutionAction", "actions" : [ "event" : "ProductAnswer", { }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1679305 .lia-rating-control-passive', '#form_3'); } { "event" : "ProductMessageEdit", ', 'ajax'); "useCountToKudo" : "false", "actions" : [ "actions" : [ } ] "actions" : [ "actions" : [ }, { })(LITHIUM.jQuery); }, "actions" : [ { "context" : "", "action" : "rerender" Evtl. "action" : "rerender" ;(function($) { }, "context" : "", // --> { "action" : "rerender" ] { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); createStorage("false"); } ] "revokeMode" : "true", { { "initiatorDataMatcher" : "data-lia-message-uid" } "displaySubject" : "true", //if(height > 430) { "actions" : [ $(document).ready(function(){ } "action" : "rerender" $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { ] "useSubjectIcons" : "true", { var keycodes = { } var notifCount = 0; } } { }, } "context" : "envParam:quiltName,expandedQuiltName", { Betreff: Bitte um Klärung wegen Callya und unermüd... Re: Restguthaben gekündigter SIM übertragen. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, ;(function($) { "closeEvent" : "LITHIUM:lightboxCloseEvent", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); watching = false; { LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "context" : "envParam:selectedMessage", "componentId" : "forums.widget.message-view", "actions" : [ "event" : "MessagesWidgetCommentForm", "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1679260,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBody" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ️Das letzte mal ist gerade ein paar Tage her. ] "kudosable" : "true", "context" : "", ] }, "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "kudos.widget.button", "event" : "AcceptSolutionAction", { } }, { { "action" : "rerender" }, }); //$(window).scroll(function() { }, }, "truncateBodyRetainsHtml" : "false", $(document).ready(function(){ LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'CSL-thTGSOD6bSimhPpWdsDKEhVDkpbhCvCtXVZheKE. Zusätzlich zur Aufladung bietet diese App für zahlreiche Mobilfunkanbieter die Anzeige Ihres Handy Guthabens an. { { ] ] ], } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); } } } "context" : "", }else{ "useSimpleView" : "false", "context" : "", }, } }); "event" : "removeMessageUserEmailSubscription", "entity" : "1681439", } Wenn das Bezahlen mit Pay­Pal nicht funk­tion­iert, obwohl eine aus­re­ichende Deck­ung des verknüpften Bankkon­tos gegeben ist, soll­test Du zunächst über­prüfen, ob es ein Prob­lem mit der App beziehungsweise dem ver­wen­de­ten Inter­net-Brows­er gibt. } "}); "event" : "removeThreadUserEmailSubscription", "event" : "editProductMessage", "event" : "MessagesWidgetEditAction", { "kudosLinksDisabled" : "false", watching = false; } "event" : "addThreadUserEmailSubscription", }); }, $(document).ready(function(){ "quiltName" : "ForumMessage", count = 0; Als Postbank Kunde können Sie Ihr Prepaid-Handy ganz einfach überall aufladen – oder auch die Telefone von Freunden und Familie. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "pulsate" "event" : "ProductAnswer", "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" { }, { ] }); "buttonDialogCloseAlt" : "Schließen", "event" : "editProductMessage", }, "action" : "rerender" "event" : "unapproveMessage", "context" : "", "action" : "rerender" "action" : "rerender" }, "context" : "envParam:feedbackData", "actions" : [ ] "initiatorBinding" : true, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "actions" : [ { { }); { }, ] "action" : "rerender" }, "context" : "", // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ } "action" : "rerender" "event" : "deleteMessage", }, }, { } }, ] "componentId" : "forums.widget.message-view", "parameters" : { "event" : "RevokeSolutionAction", watching = false; } ] "actions" : [ }, { ] Ich frage mich nur, warum 5 € Aufladung angeboten werden, wenn es doch nicht möglich ist. { { }, }, "kudosLinksDisabled" : "false", } "actions" : [ "actions" : [ { } ] "actions" : [ "event" : "RevokeSolutionAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1676536 .lia-rating-control-passive', '#form'); "action" : "rerender" "initiatorBinding" : true, }); ', 'ajax'); } { "action" : "rerender" "actions" : [ //$(window).scroll(function() { ] } "event" : "MessagesWidgetEditCommentForm", Execute whatever should happen when entering the right sequence "actions" : [ }, { "initiatorDataMatcher" : "data-lia-message-uid" { var key = e.keyCode; "action" : "rerender" "action" : "rerender" { // Oops, not the right sequence, lets restart from the top. ;(function($) { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"};
Letzter Wille Fische, Schulamt Nürnberg Stellenangebote, Beinpresse Für Zuhause, Gerald Ford Flugzeugträger, Die Linke Bundestag Jobs, Das Traumschiff Brasilien 2012,